SCOP 1.59: Domain d1ddna2: 1ddn A:65-120

Lineage for d1ddna2 (1ddn A:65-120)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)

4. Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries)

8. Domain d1ddna2: 1ddn A:65-120 [18413]
   Other proteins in same PDB: d1ddna1, d1ddnb1, d1ddnc1, d1ddnd1

Details for d1ddna2

PDB Entry: 1ddn, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant)/tox dna operator complex

SCOP Domain Sequences for d1ddna2:

Sequence; same for both SEQRES and ATOM records:

>d1ddna2 a.76.1.1 (A:65-120) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl

Timeline for d1ddna2:

• d1ddna2 first appeared (with stable ids) in SCOP 1.55
  
• d1ddna2 appears in SCOP 1.57
  
• d1ddna2 appears in SCOP 1.61
  
• d1ddna2 appears in the current release, SCOPe 2.08