Lineage for d3q0pa_ (3q0p A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725793Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 2725794Protein Pumilio 1 [63612] (1 species)
  7. 2725795Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries)
  8. 2725809Domain d3q0pa_: 3q0p A: [184128]
    automated match to d1m8yb_
    protein/RNA complex; complexed with cl

Details for d3q0pa_

PDB Entry: 3q0p (more details), 2.6 Å

PDB Description: Crystal structure of the PUMILIO-homology domain from Human PUMILIO1 in complex with hunchback NRE
PDB Compounds: (A:) Pumilio homolog 1

SCOPe Domain Sequences for d3q0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0pa_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilaklekyy

SCOPe Domain Coordinates for d3q0pa_:

Click to download the PDB-style file with coordinates for d3q0pa_.
(The format of our PDB-style files is described here.)

Timeline for d3q0pa_: