Lineage for d3q0nb_ (3q0n B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 921850Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 922023Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
  6. 922024Protein Pumilio 1 [63612] (1 species)
  7. 922025Species Human (Homo sapiens) [TaxId:9606] [63613] (12 PDB entries)
  8. 922033Domain d3q0nb_: 3q0n B: [184125]
    automated match to d1m8yb_
    protein/RNA complex

Details for d3q0nb_

PDB Entry: 3q0n (more details), 2.4 Å

PDB Description: Crystal structure of the PUMILIO-homology domain from Human PUMILIO1 in complex with erk2 NRE
PDB Compounds: (B:) Pumilio homolog 1

SCOPe Domain Sequences for d3q0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0nb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilakleky

SCOPe Domain Coordinates for d3q0nb_:

Click to download the PDB-style file with coordinates for d3q0nb_.
(The format of our PDB-style files is described here.)

Timeline for d3q0nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3q0na_