![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.8: Pumilio repeat [63611] (2 proteins) this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain |
![]() | Protein Pumilio 1 [63612] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries) |
![]() | Domain d3q0nb_: 3q0n B: [184125] automated match to d1m8yb_ protein/RNA complex |
PDB Entry: 3q0n (more details), 2.4 Å
SCOPe Domain Sequences for d3q0nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q0nb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk midvaepgqrkivmhkirphiatlrkytygkhilakleky
Timeline for d3q0nb_: