SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3q0na_ (3q0n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006652Family a.118.1.8: Pumilio repeat [63611] (2 protein domains)
  6. 2006653Protein Pumilio 1 [63612] (1 species)
  7. 2006654Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries)
  8. 2006660Domain d3q0na_: 3q0n A: [184124]
    automated match to d1m8yb_
    protein/RNA complex

Details for d3q0na_

PDB Entry: 3q0n (more details), 2.4 Å

PDB Description: Crystal structure of the PUMILIO-homology domain from Human PUMILIO1 in complex with erk2 NRE
PDB Compounds: (A:) Pumilio homolog 1

SCOPe Domain Sequences for d3q0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0na_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilaklekyy

SCOPe Domain Coordinates for d3q0na_:

Click to download the PDB-style file with coordinates for d3q0na_.
(The format of our PDB-style files is described here.)

Timeline for d3q0na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3q0nb_