Lineage for d3q0lb_ (3q0l B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338866Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 2338867Protein Pumilio 1 [63612] (1 species)
  7. 2338868Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries)
  8. 2338879Domain d3q0lb_: 3q0l B: [184121]
    automated match to d1m8yb_
    protein/RNA complex

Details for d3q0lb_

PDB Entry: 3q0l (more details), 2.5 Å

PDB Description: Crystal structure of the PUMILIO-homology domain from Human PUMILIO1 in complex with p38alpha NREa
PDB Compounds: (B:) Pumilio homolog 1

SCOPe Domain Sequences for d3q0lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0lb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilakleky

SCOPe Domain Coordinates for d3q0lb_:

Click to download the PDB-style file with coordinates for d3q0lb_.
(The format of our PDB-style files is described here.)

Timeline for d3q0lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3q0la_