SCOPe 2.08: Domain d3q0lb_: 3q0l B:

Lineage for d3q0lb_ (3q0l B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
   this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain

6. Protein Pumilio 1 [63612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries)

8. Domain d3q0lb_: 3q0l B: [184121]
   automated match to d1m8yb_
   protein/RNA complex

Details for d3q0lb_

PDB Entry: 3q0l, 2.5 Å

PDB Description: Crystal structure of the PUMILIO-homology domain from Human PUMILIO1 in complex with p38alpha NREa

PDB Compounds: (B:) Pumilio homolog 1

SCOPe Domain Sequences for d3q0lb_:

Sequence; same for both SEQRES and ATOM records:

>d3q0lb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilakleky

Timeline for d3q0lb_:

• d3q0lb_ first appeared in SCOPe 2.01
  
• d3q0lb_ appears in SCOPe 2.07