SCOPe 2.08: Domain d3q0jb1: 3q0j B:1-254

Lineage for d3q0jb1 (3q0j B:1-254)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187022] (13 PDB entries)

8. Domain d3q0jb1: 3q0j B:1-254 [184115]
   Other proteins in same PDB: d3q0jb2
   automated match to d1duba_
   complexed with caa

Details for d3q0jb1

PDB Entry: 3q0j, 2.4 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Crotonase in complex with the Inhibitor AcetoacetylCoA

PDB Compounds: (B:) enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3q0jb1:

Sequence; same for both SEQRES and ATOM records:

>d3q0jb1 c.14.1.0 (B:1-254) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsaka
faagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvli
aadtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvv
paddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqs
egmaafiekrapqf

Timeline for d3q0jb1:

• d3q0jb1 first appeared in SCOPe 2.01, called d3q0jb_
  
• d3q0jb1 appears in SCOPe 2.07