Lineage for d3q0gf_ (3q0g F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113448Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries)
  8. 2113493Domain d3q0gf_: 3q0g F: [184113]
    automated match to d1duba_
    complexed with bco, coa, gol, mg

Details for d3q0gf_

PDB Entry: 3q0g (more details), 2.38 Å

PDB Description: crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
PDB Compounds: (F:) enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3q0gf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0gf_ c.14.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
gmaafiekrapqft

SCOPe Domain Coordinates for d3q0gf_:

Click to download the PDB-style file with coordinates for d3q0gf_.
(The format of our PDB-style files is described here.)

Timeline for d3q0gf_: