SCOPe 2.01: Domain d3q0gf_: 3q0g F:

Lineage for d3q0gf_ (3q0g F:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (10 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187022] (4 PDB entries)

8. Domain d3q0gf_: 3q0g F: [184113]
   automated match to d1duba_
   complexed with bco, coa, gol, mg

Details for d3q0gf_

PDB Entry: 3q0g, 2.38 Å

PDB Description: crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa

PDB Compounds: (F:) enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3q0gf_:

Sequence; same for both SEQRES and ATOM records:

>d3q0gf_ c.14.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
gmaafiekrapqft

Timeline for d3q0gf_:

• d3q0gf_ is new in SCOPe 2.01-stable
  
• d3q0gf_ appears in SCOPe 2.02
  
• d3q0gf_ appears in the current release, SCOPe 2.08