Lineage for d3q02b_ (3q02 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2243858Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2243859Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2243860Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2244035Protein automated matches [190484] (2 species)
    not a true protein
  7. 2244036Species Human (Homo sapiens) [TaxId:9606] [188559] (15 PDB entries)
  8. 2244047Domain d3q02b_: 3q02 B: [184102]
    automated match to d1c5ga_
    complexed with cl, edo, zn

Details for d3q02b_

PDB Entry: 3q02 (more details), 2.3 Å

PDB Description: crystal structure of plasminogen activator inhibitor-1 in a metastable active conformation.
PDB Compounds: (B:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d3q02b_:

Sequence, based on SEQRES records: (download)

>d3q02b_ e.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfp
dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
qfqadftslsdqeplhvaqalqkvkievnesgtvassstavivsarmapeeiimdrpflf
vvrhnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d3q02b_ e.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfp
dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
qfqadftslsdqeplhvaqalqkvkievnespeeiimdrpflfvvrhnptgtvlfmgqvm
ep

SCOPe Domain Coordinates for d3q02b_:

Click to download the PDB-style file with coordinates for d3q02b_.
(The format of our PDB-style files is described here.)

Timeline for d3q02b_: