Lineage for d3q02a_ (3q02 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568352Species Human (Homo sapiens) [TaxId:9606] [188559] (17 PDB entries)
  8. 2568367Domain d3q02a_: 3q02 A: [184101]
    automated match to d1c5ga_
    complexed with cl, edo, zn

Details for d3q02a_

PDB Entry: 3q02 (more details), 2.3 Å

PDB Description: crystal structure of plasminogen activator inhibitor-1 in a metastable active conformation.
PDB Compounds: (A:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d3q02a_:

Sequence, based on SEQRES records: (download)

>d3q02a_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
fseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfpdssth
rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
ftslsdqeplhvaqalqkvkievnesgtvassstavivsarmapeeiimdrpflfvvrhn
ptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d3q02a_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
fseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfpdssth
rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
ftslsdqeplhvaqalqkvkievnesapeeiimdrpflfvvrhnptgtvlfmgqvmep

SCOPe Domain Coordinates for d3q02a_:

Click to download the PDB-style file with coordinates for d3q02a_.
(The format of our PDB-style files is described here.)

Timeline for d3q02a_: