SCOPe 2.01: Domain d3pzsb_: 3pzs B:

Lineage for d3pzsb_ (3pzs B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
   includes a variety of carbohydrate and pyrimidine kinases

6. Protein automated matches [190479] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [189669] (1 PDB entry)

8. Domain d3pzsb_: 3pzs B: [184097]
   automated match to d1td2a_
   complexed with bme, na, so4

Details for d3pzsb_

PDB Entry: 3pzs, 1.89 Å

PDB Description: Crystal Structure of a pyridoxamine kinase from Yersinia pestis CO92

PDB Compounds: (B:) Pyridoxamine kinase

SCOPe Domain Sequences for d3pzsb_:

Sequence; same for both SEQRES and ATOM records:

>d3pzsb_ c.72.1.5 (B:) automated matches {Yersinia pestis [TaxId: 214092]}
mknilsiqshvvfghagnsaaefpmrrmgvnvwplntvqfsnhtqyghwtgcvmpashlt
divqgiadidrlkdcdavlsgyigspeqgshilaavaqvkqanpdawyfcdpvmghpekg
civapgvaeffcnealpasdmiapnlleleqlsgervenveqavqvarslcargpkvvlv
khlsragyhadcfemllvtaddawhicrplvdfgkrqpvgvgdltsglllvnllkgepld
kalehvtaavyevmlktqemgeyelqvvaaqetivtpicqftavrl

Timeline for d3pzsb_:

• d3pzsb_ is new in SCOPe 2.01-stable
  
• d3pzsb_ appears in SCOPe 2.02
  
• d3pzsb_ appears in the current release, SCOPe 2.08