Lineage for d3pzsa_ (3pzs A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872591Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 1872620Protein automated matches [190479] (2 species)
    not a true protein
  7. 1872640Species Yersinia pestis [TaxId:214092] [189669] (1 PDB entry)
  8. 1872641Domain d3pzsa_: 3pzs A: [184096]
    automated match to d1td2a_
    complexed with bme, na, so4

Details for d3pzsa_

PDB Entry: 3pzs (more details), 1.89 Å

PDB Description: Crystal Structure of a pyridoxamine kinase from Yersinia pestis CO92
PDB Compounds: (A:) Pyridoxamine kinase

SCOPe Domain Sequences for d3pzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzsa_ c.72.1.5 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
knilsiqshvvfghagnsaaefpmrrmgvnvwplntvqfsnhtqyghwtgcvmpashltd
ivqgiadidrlkdcdavlsgyigspeqgshilaavaqvkqanpdawyfcdpvmghpekgc
ivapgvaeffcnealpasdmiapnlleleqlsgervenveqavqvarslcargpkvvlvk
hlsragyhadcfemllvtaddawhicrplvdfgkrqpvgvgdltsglllvnllkgepldk
alehvtaavyevmlktqemgeyelqvvaaqetivtpicqftavrl

SCOPe Domain Coordinates for d3pzsa_:

Click to download the PDB-style file with coordinates for d3pzsa_.
(The format of our PDB-style files is described here.)

Timeline for d3pzsa_: