Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.5: PfkB-like kinase [82515] (3 proteins) includes a variety of carbohydrate and pyrimidine kinases |
Protein automated matches [190479] (2 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [189669] (1 PDB entry) |
Domain d3pzsa_: 3pzs A: [184096] automated match to d1td2a_ complexed with bme, na, so4 |
PDB Entry: 3pzs (more details), 1.89 Å
SCOPe Domain Sequences for d3pzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pzsa_ c.72.1.5 (A:) automated matches {Yersinia pestis [TaxId: 214092]} knilsiqshvvfghagnsaaefpmrrmgvnvwplntvqfsnhtqyghwtgcvmpashltd ivqgiadidrlkdcdavlsgyigspeqgshilaavaqvkqanpdawyfcdpvmghpekgc ivapgvaeffcnealpasdmiapnlleleqlsgervenveqavqvarslcargpkvvlvk hlsragyhadcfemllvtaddawhicrplvdfgkrqpvgvgdltsglllvnllkgepldk alehvtaavyevmlktqemgeyelqvvaaqetivtpicqftavrl
Timeline for d3pzsa_: