![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (71 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [189677] (9 PDB entries) |
![]() | Domain d3pzkc_: 3pzk C: [184095] automated match to d1duba_ complexed with so4 |
PDB Entry: 3pzk (more details), 2.23 Å
SCOPe Domain Sequences for d3pzkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pzkc_ c.14.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} yetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakafa agadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvliaa dtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvpa ddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqseg maafiekrapqf
Timeline for d3pzkc_: