Lineage for d3pz4b_ (3pz4 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277123Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1277124Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 1277139Species Mouse (Mus musculus) [TaxId:10090] [189949] (1 PDB entry)
  8. 1277140Domain d3pz4b_: 3pz4 B: [184090]
    automated match to d1jcqb_
    complexed with 3pz, fpp, zn

Details for d3pz4b_

PDB Entry: 3pz4 (more details), 2.1 Å

PDB Description: Crystal structure of FTase(ALPHA-subunit; BETA-subunit DELTA C10) in complex with BMS3 and lipid substrate FPP
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3pz4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pz4b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf
gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d3pz4b_:

Click to download the PDB-style file with coordinates for d3pz4b_.
(The format of our PDB-style files is described here.)

Timeline for d3pz4b_: