Lineage for d3pz3b_ (3pz3 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330425Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2330553Family a.102.4.3: Protein prenyltransferases [48246] (3 protein domains)
  6. 2330670Protein Rab geranylgeranyltransferase, beta subunit [48249] (1 species)
  7. 2330671Species Norway rat (Rattus norvegicus) [TaxId:10116] [48250] (21 PDB entries)
  8. 2330683Domain d3pz3b_: 3pz3 B: [184089]
    automated match to d1dceb_
    complexed with ca, pz3, zn

Details for d3pz3b_

PDB Entry: 3pz3 (more details), 2 Å

PDB Description: crystal structure of rabggtase(delta lrr; delta ig) in complex with bms-analogue 14
PDB Compounds: (B:) Geranylgeranyl transferase type-2 subunit beta

SCOPe Domain Sequences for d3pz3b_:

Sequence, based on SEQRES records: (download)

>d3pz3b_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgqlh
rmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvq
slqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcr
pgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcysww
vlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgee
qikpvspvfcmpeevlqrvnvqpelvs

Sequence, based on observed residues (ATOM records): (download)

>d3pz3b_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
pvspvfcmpeevlqrvnvqpelvs

SCOPe Domain Coordinates for d3pz3b_:

Click to download the PDB-style file with coordinates for d3pz3b_.
(The format of our PDB-style files is described here.)

Timeline for d3pz3b_: