Lineage for d3pyya_ (3pyy A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674055Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)
  8. 1674127Domain d3pyya_: 3pyy A: [184086]
    automated match to d1opjb_
    complexed with 2pe, 3yy, gol, so4, sti

Details for d3pyya_

PDB Entry: 3pyy (more details), 1.85 Å

PDB Description: discovery and characterization of a cell-permeable, small-molecule c- abl kinase activator that binds to the myristoyl binding site
PDB Compounds: (A:) V-abl Abelson murine leukemia viral oncogene homolog 1 isoform b variant

SCOPe Domain Sequences for d3pyya_:

Sequence, based on SEQRES records: (download)

>d3pyya_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqes

Sequence, based on observed residues (ATOM records): (download)

>d3pyya_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkeveeflkeaavmkeikh
pnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyle
kknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynk
fsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmrac
wqwnpsdrpsfaeihqafetmfqes

SCOPe Domain Coordinates for d3pyya_:

Click to download the PDB-style file with coordinates for d3pyya_.
(The format of our PDB-style files is described here.)

Timeline for d3pyya_: