SCOPe 2.03: Domain d1bi0a2: 1bi0 A:65-140

Lineage for d1bi0a2 (1bi0 A:65-140)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (17 PDB entries)
   Uniprot P33120

8. Domain d1bi0a2: 1bi0 A:65-140 [18408]
   Other proteins in same PDB: d1bi0a1, d1bi0a3
   complexed with so4, zn

Details for d1bi0a2

PDB Entry: 1bi0, 2.3 Å

PDB Description: structure of apo-and holo-diphtheria toxin repressor

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1bi0a2:

Sequence; same for both SEQRES and ATOM records:

>d1bi0a2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

Timeline for d1bi0a2:

• d1bi0a2 first appeared (with stable ids) in SCOP 1.55, called d1bi0_2
  
• d1bi0a2 appears in SCOPe 2.02
  
• d1bi0a2 appears in SCOPe 2.04
  
• d1bi0a2 appears in the current release, SCOPe 2.08