![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [47982] (17 PDB entries) Uniprot P33120 |
![]() | Domain d1bi0a2: 1bi0 A:65-140 [18408] Other proteins in same PDB: d1bi0a1, d1bi0a3 complexed with so4, zn |
PDB Entry: 1bi0 (more details), 2.3 Å
SCOPe Domain Sequences for d1bi0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi0a2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs rspfgnpipgldelgv
Timeline for d1bi0a2: