SCOPe 2.06: Domain d2tdxa2: 2tdx A:65-139

Lineage for d2tdxa2 (2tdx A:65-139)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
   Uniprot P33120

8. Domain d2tdxa2: 2tdx A:65-139 [18407]
   Other proteins in same PDB: d2tdxa1
   protein/DNA complex; complexed with ni; mutant

Details for d2tdxa2

PDB Entry: 2tdx, 2.4 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel

PDB Compounds: (A:) diphtheria tox repressor

SCOPe Domain Sequences for d2tdxa2:

Sequence; same for both SEQRES and ATOM records:

>d2tdxa2 a.76.1.1 (A:65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg

Timeline for d2tdxa2:

• d2tdxa2 first appeared (with stable ids) in SCOP 1.55, called d2tdx_2
  
• d2tdxa2 appears in SCOPe 2.05
  
• d2tdxa2 appears in SCOPe 2.07
  
• d2tdxa2 appears in the current release, SCOPe 2.08