Lineage for d2tdx_2 (2tdx 65-139)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily) Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) 
Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins) 
Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries) 
Domain d2tdx_2: 2tdx 65-139 [18407]
Other proteins in same PDB: d2tdx_1
Details for d2tdx_2
PDB Entry: 2tdx (more details), 2.4 Å
PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel
SCOP Domain Sequences for d2tdx_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tdx_2 a.76.1.1 (65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg
SCOP Domain Coordinates for d2tdx_2:
Click to download the PDB-style file with coordinates for d2tdx_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tdx_2:
- d2tdx_2 first appeared (with stable ids) in SCOP 1.55
- d2tdx_2 appears in SCOP 1.57
- d2tdx_2 appears in SCOP 1.61
- d2tdx_2 appears in the current release, SCOPe 2.08, called d2tdxa2
View in 3D
