Lineage for d2tdx_2 (2tdx 65-139)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49303Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)
  4. 49304Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) (S)
  5. 49305Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)
  6. 49306Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 49307Species Corynebacterium diphtheriae [TaxId:1717] [47982] (11 PDB entries)
  8. 49316Domain d2tdx_2: 2tdx 65-139 [18407]
    Other proteins in same PDB: d2tdx_1

Details for d2tdx_2

PDB Entry: 2tdx (more details), 2.4 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel

SCOP Domain Sequences for d2tdx_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tdx_2 a.76.1.1 (65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg

SCOP Domain Coordinates for d2tdx_2:

Click to download the PDB-style file with coordinates for d2tdx_2.
(The format of our PDB-style files is described here.)

Timeline for d2tdx_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2tdx_1