Lineage for d3pxua_ (3pxu A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 985275Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 985276Protein automated matches [190459] (13 species)
    not a true protein
  7. 985280Species Burkholderia pseudomallei [TaxId:320372] [189579] (1 PDB entry)
  8. 985281Domain d3pxua_: 3pxu A: [184069]
    automated match to d1b6ta_
    complexed with cod, gol, so4

Details for d3pxua_

PDB Entry: 3pxu (more details), 2.1 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei bound to dephospho-coenzyme a
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3pxua_:

Sequence, based on SEQRES records: (download)

>d3pxua_ c.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
smvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlg
hypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmfmtp
sdqyqfisgtivreiaqlggdvskfvfpsvekwltekvaama

Sequence, based on observed residues (ATOM records): (download)

>d3pxua_ c.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
smvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlg
hypnvkvmgftgllkdfvrandarvivrglrafeyefqmagmnryllpdvetmfmtpsdq
yqfisgtivreiaqlggdvskfvfpsvekwltekvaama

SCOPe Domain Coordinates for d3pxua_:

Click to download the PDB-style file with coordinates for d3pxua_.
(The format of our PDB-style files is described here.)

Timeline for d3pxua_: