Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (61 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [189579] (3 PDB entries) |
Domain d3pxua1: 3pxu A:1-161 [184069] Other proteins in same PDB: d3pxua2 automated match to d1b6ta_ complexed with cod, gol, so4 |
PDB Entry: 3pxu (more details), 2.1 Å
SCOPe Domain Sequences for d3pxua1:
Sequence, based on SEQRES records: (download)
>d3pxua1 c.26.1.0 (A:1-161) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlgh ypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmfmtps dqyqfisgtivreiaqlggdvskfvfpsvekwltekvaama
>d3pxua1 c.26.1.0 (A:1-161) automated matches {Burkholderia pseudomallei [TaxId: 320372]} mvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlgh ypnvkvmgftgllkdfvrandarvivrglrafeyefqmagmnryllpdvetmfmtpsdqy qfisgtivreiaqlggdvskfvfpsvekwltekvaama
Timeline for d3pxua1: