Lineage for d3pxtc_ (3pxt C:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064542Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1064543Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1064544Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
  6. 1064565Protein automated matches [190303] (2 species)
    not a true protein
  7. 1064582Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)
  8. 1064595Domain d3pxtc_: 3pxt C: [184067]
    automated match to d1mg2b_
    complexed with act, ca, cmo, hec, na, pg6

Details for d3pxtc_

PDB Entry: 3pxt (more details), 2.16 Å

PDB Description: crystal structure of ferrous co adduct of maug in complex with pre- methylamine dehydrogenase
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3pxtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxtc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3pxtc_:

Click to download the PDB-style file with coordinates for d3pxtc_.
(The format of our PDB-style files is described here.)

Timeline for d3pxtc_: