Lineage for d3pxma_ (3pxm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935699Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 2935722Protein automated matches [190339] (1 species)
    not a true protein
  7. 2935723Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (15 PDB entries)
  8. 2935731Domain d3pxma_: 3pxm A: [184061]
    automated match to d1m9ga_
    mutant

Details for d3pxma_

PDB Entry: 3pxm (more details), 1.8 Å

PDB Description: reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
PDB Compounds: (A:) Monellin chain B/Monellin chain A chimeric protein

SCOPe Domain Sequences for d3pxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxma_ d.17.1.1 (A:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkairpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d3pxma_:

Click to download the PDB-style file with coordinates for d3pxma_.
(The format of our PDB-style files is described here.)

Timeline for d3pxma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3pxmb_