Lineage for d3px7a_ (3px7 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018324Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. 3018325Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (2 families) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. 3018326Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (4 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. 3018352Protein automated matches [191216] (2 species)
    not a true protein
  7. 3018355Species Escherichia coli [TaxId:536056] [189925] (1 PDB entry)
  8. 3018356Domain d3px7a_: 3px7 A: [184055]
    automated match to d1cy1a_
    protein/DNA complex; complexed with hg

Details for d3px7a_

PDB Entry: 3px7 (more details), 2.3 Å

PDB Description: crystal structure of covalent complex of topoisomerase 1a with substrate
PDB Compounds: (A:) DNA topoisomerase

SCOPe Domain Sequences for d3px7a_:

Sequence, based on SEQRES records: (download)

>d3px7a_ e.10.1.1 (A:) automated matches {Escherichia coli [TaxId: 536056]}
gkalvivespakaktinkylgsdyvvkssvghirdlptsgsaakksadststktakkpkk
dergalvnrmgvdpwhnweahyevlpgkekvvselkqlaekadhiylatnldregeaiaw
hlreviggddarysrvvfneitknairqafnkpgelnidrvnaqqarrfmdrvvgymvsp
llwkkiarglsagrvqsvavrlvverereikafvpeefwevdastttpsgealalqvthq
ndkpfrpvnkeqtqaavsllekarysvleredkpttskpgapfitstlqqaastrlgfgv
kktmmmaqrlyeagyitymrtdstnlsqdavnmvrgyisdnfgkkylpespnqyaskens
qeaheairpsdvnvmaeslkdmeadaqklyqliwrqfvacqmtpakydsttltvgagdfr
lkargrilrfdgwtkvmpalrkgdedrilpavnkgdaltlveltpaqhftkpparfseas
lvkelekrgigrpstyasiistiqdrgyvrvenrrfyaekmgeivtdrleenfrelmnyd
ftaqmensldqvanheaewkavldhffsdftqqldkaekdpeeggmrpn

Sequence, based on observed residues (ATOM records): (download)

>d3px7a_ e.10.1.1 (A:) automated matches {Escherichia coli [TaxId: 536056]}
gkalvivespakaktinkylgsdyvvkssvghirdlpdergalvnrmgvdpwhnweahye
vlpgkekvvselkqlaekadhiylatnldregeaiawhlreviggddarysrvvfneitk
nairqafnkpgelnidrvnaqqarrfmdrvvgymvspllwkkiarglsagrvqsvavrlv
verereikafvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavslleka
rysvleredkpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtds
tnlsqdavnmvrgyisdnfgkkylpespnqyaheairpsdvnvmaeslkdmeadaqklyq
liwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalrilpavnkgda
ltlveltpaqhftkpparfseaslvkelekrgigrpstyasiistiqdrgyvrvenrrfy
aekmgeivtdrleenfrelmnydftaqmensldqvanheaewkavldhffsdftqqldka
ekdpeeggmrpn

SCOPe Domain Coordinates for d3px7a_:

Click to download the PDB-style file with coordinates for d3px7a_.
(The format of our PDB-style files is described here.)

Timeline for d3px7a_: