Lineage for d3pwwa_ (3pww A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1550211Protein automated matches [190156] (4 species)
    not a true protein
  7. 1550214Species Cryphonectria parasitica [TaxId:5116] [187236] (21 PDB entries)
  8. 1550217Domain d3pwwa_: 3pww A: [184054]
    automated match to d1e5oe_
    complexed with gol, roc

Details for d3pwwa_

PDB Entry: 3pww (more details), 1.22 Å

PDB Description: Endothiapepsin in complex with saquinavir
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d3pwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwwa_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d3pwwa_:

Click to download the PDB-style file with coordinates for d3pwwa_.
(The format of our PDB-style files is described here.)

Timeline for d3pwwa_: