Lineage for d3pwta_ (3pwt A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018324Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. 3018325Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (2 families) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. 3018326Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (4 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. 3018352Protein automated matches [191216] (2 species)
    not a true protein
  7. 3018353Species Escherichia coli K-12 [TaxId:83333] [189588] (1 PDB entry)
  8. 3018354Domain d3pwta_: 3pwt A: [184053]
    automated match to d1cy1a_
    complexed with so4; mutant

Details for d3pwta_

PDB Entry: 3pwt (more details), 1.9 Å

PDB Description: crystal structure of mutant e.coli topoisomerase ia
PDB Compounds: (A:) DNA topoisomerase

SCOPe Domain Sequences for d3pwta_:

Sequence, based on SEQRES records: (download)

>d3pwta_ e.10.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gkalvivespakaktinkylgsdyvvkssvghirdlptsgsaakksadststktakkpkk
dergalvnrmgvdpwhnweahyevlpgkekvvselkqlaekadhiylatnldregeaiaw
hlreviggddarysrvvfneitknairqafnkpgelnidrvnaqqarrfmdrvvgymvsp
llwkkiarglsagrvqsvavrlvverereikafvpeefwevdastttpsgealalqvthq
ndkpfrpvnkeqtqaavsllekarysvleredkpttskpgapfitstlqqaastrlgfgv
kktmmmaqrlyeagyitymrtdstnlsqdavnmvrgyisdnfgkkylpespnqyaskens
qeaheairpsdvnvmaeslkdmeadaqklyqliwrqfvacqmtpakydsttltvgagdfr
lkargrilrfdgwtkvmpalrkgdedrilpavnkgdaltlveltpaqhftkpparfseas
lvkelekrgigrpstyasiistiqdrgyvrvenrrfyaekmgeivtdrleenfrelmnyd
ftaqmensldqvanheaewkavldhffsdftqqldkaekdpeeggmrpnqmvlt

Sequence, based on observed residues (ATOM records): (download)

>d3pwta_ e.10.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gkalvivespakaktinkylgsdyvvkssvghirdlptdergalvnrmgvdpwhnweahy
evlpgkekvvselkqlaekadhiylatnldregeaiawhlreviggddarysrvvfneit
knairqafnkpgelnidrvnaqqarrfmdrvvgymvspllwkkiarglsagrvqsvavrl
vverereikafvpeefwevdastttpsgealalqvthqndkpfrpvnkeqtqaavsllek
arysvleredkpttskpgapfitstlqqaastrlgfgvkktmmmaqrlyeagyitymrtd
stnlsqdavnmvrgyisdnfgkkylpespnqyaaheairpsdvnvmaeslkdmeadaqkl
yqliwrqfvacqmtpakydsttltvgagdfrlkargrilrfdgwtkvmpalredrilpav
nkgdaltlveltpaqhftkpparfseaslvkelekrgigrpstyasiistiqdrgyvrve
nrrfyaekmgeivtdrleenfrelmnydftaqmensldqvanheaewkavldhffsdftq
qldkaekdpeeggmrpnqmvlt

SCOPe Domain Coordinates for d3pwta_:

Click to download the PDB-style file with coordinates for d3pwta_.
(The format of our PDB-style files is described here.)

Timeline for d3pwta_: