Lineage for d3pwqk_ (3pwq K:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729468Protein automated matches [190435] (9 species)
    not a true protein
  7. 1729513Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)
  8. 1729528Domain d3pwqk_: 3pwq K: [184049]
    automated match to d1otka_

Details for d3pwqk_

PDB Entry: 3pwq (more details), 2.65 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex
PDB Compounds: (K:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pwqk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwqk_ a.25.1.2 (K:) automated matches {Escherichia coli [TaxId: 511145]}
taytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelagegd
edtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaaisa
kaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialseegi
avdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqy

SCOPe Domain Coordinates for d3pwqk_:

Click to download the PDB-style file with coordinates for d3pwqk_.
(The format of our PDB-style files is described here.)

Timeline for d3pwqk_: