Lineage for d3pwqi1 (3pwq I:2-238)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316867Protein automated matches [190435] (12 species)
    not a true protein
  7. 2316912Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)
  8. 2316925Domain d3pwqi1: 3pwq I:2-238 [184047]
    Other proteins in same PDB: d3pwqa2, d3pwqb2, d3pwqe2, d3pwqg2, d3pwqi2, d3pwqj2, d3pwqr2
    automated match to d1otka_

Details for d3pwqi1

PDB Entry: 3pwq (more details), 2.65 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex
PDB Compounds: (I:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pwqi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwqi1 a.25.1.2 (I:2-238) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqy

SCOPe Domain Coordinates for d3pwqi1:

Click to download the PDB-style file with coordinates for d3pwqi1.
(The format of our PDB-style files is described here.)

Timeline for d3pwqi1: