Lineage for d3pwqi_ (3pwq I:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911990Protein automated matches [190435] (4 species)
    not a true protein
  7. 911998Species Escherichia coli [TaxId:511145] [189613] (6 PDB entries)
  8. 912011Domain d3pwqi_: 3pwq I: [184047]
    automated match to d1otka_

Details for d3pwqi_

PDB Entry: 3pwq (more details), 2.65 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex
PDB Compounds: (I:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pwqi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwqi_ a.25.1.2 (I:) automated matches {Escherichia coli [TaxId: 511145]}
snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela
gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla
aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials
eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqy

SCOPe Domain Coordinates for d3pwqi_:

Click to download the PDB-style file with coordinates for d3pwqi_.
(The format of our PDB-style files is described here.)

Timeline for d3pwqi_: