SCOPe 2.01: Domain d3pwqi_: 3pwq I:

Lineage for d3pwqi_ (3pwq I:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [189613] (6 PDB entries)

8. Domain d3pwqi_: 3pwq I: [184047]
   automated match to d1otka_

Details for d3pwqi_

PDB Entry: 3pwq, 2.65 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex

PDB Compounds: (I:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pwqi_:

Sequence; same for both SEQRES and ATOM records:

>d3pwqi_ a.25.1.2 (I:) automated matches {Escherichia coli [TaxId: 511145]}
snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela
gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla
aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials
eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqy

Timeline for d3pwqi_:

• d3pwqi_ is new in SCOPe 2.01-stable
  
• d3pwqi_ appears in SCOPe 2.02
  
• d3pwqi_ appears in the current release, SCOPe 2.08, called d3pwqi1