Lineage for d1bi2b2 (1bi2 B:65-140)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49303Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)
  4. 49304Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) (S)
  5. 49305Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)
  6. 49306Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 49307Species Corynebacterium diphtheriae [TaxId:1717] [47982] (11 PDB entries)
  8. 49312Domain d1bi2b2: 1bi2 B:65-140 [18404]
    Other proteins in same PDB: d1bi2a1, d1bi2a3, d1bi2b1

Details for d1bi2b2

PDB Entry: 1bi2 (more details), 2.3 Å

PDB Description: structure of apo-and holo-diphtheria toxin repressor

SCOP Domain Sequences for d1bi2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi2b2 a.76.1.1 (B:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOP Domain Coordinates for d1bi2b2:

Click to download the PDB-style file with coordinates for d1bi2b2.
(The format of our PDB-style files is described here.)

Timeline for d1bi2b2: