Lineage for d3pwda_ (3pwd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982560Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2982813Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)
  8. 2982846Domain d3pwda_: 3pwd A: [184033]
    automated match to d1f0qa_
    complexed with cz0

Details for d3pwda_

PDB Entry: 3pwd (more details), 2.2 Å

PDB Description: crystal structure of maize ck2 in complex with nbc (z1)
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3pwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwda_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

SCOPe Domain Coordinates for d3pwda_:

Click to download the PDB-style file with coordinates for d3pwda_.
(The format of our PDB-style files is described here.)

Timeline for d3pwda_: