Lineage for d3pw8b_ (3pw8 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703653Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)
  8. 2703671Domain d3pw8b_: 3pw8 B: [184028]
    automated match to d1otka_
    complexed with aco

Details for d3pw8b_

PDB Entry: 3pw8 (more details), 2.97 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with acetyl-CoA
PDB Compounds: (B:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pw8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pw8b_ a.25.1.2 (B:) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr
vlpgqqw

SCOPe Domain Coordinates for d3pw8b_:

Click to download the PDB-style file with coordinates for d3pw8b_.
(The format of our PDB-style files is described here.)

Timeline for d3pw8b_: