SCOPe 2.05: Domain d3pvug_: 3pvu G:

Lineage for d3pvug_ (3pvu G:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries)

8. Domain d3pvug_: 3pvu G: [184020]
   Other proteins in same PDB: d3pvua1, d3pvua2, d3pvua3, d3pvub_
   automated match to d1omwg_
   complexed with qrw

Details for d3pvug_

PDB Entry: 3pvu, 2.48 Å

PDB Description: Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD101)

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d3pvug_:

Sequence; same for both SEQRES and ATOM records:

>d3pvug_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
c

Timeline for d3pvug_:

• d3pvug_ first appeared in SCOPe 2.01
  
• d3pvug_ appears in SCOPe 2.04
  
• d3pvug_ appears in SCOPe 2.06
  
• d3pvug_ appears in the current release, SCOPe 2.08