Lineage for d1bi1a2 (1bi1 A:65-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718817Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2718818Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2718819Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2718820Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 2718821Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 2718825Domain d1bi1a2: 1bi1 A:65-140 [18402]
    Other proteins in same PDB: d1bi1a1, d1bi1a3

Details for d1bi1a2

PDB Entry: 1bi1 (more details), 2.2 Å

PDB Description: structure of apo-and holo-diphtheria toxin repressor
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1bi1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi1a2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOPe Domain Coordinates for d1bi1a2:

Click to download the PDB-style file with coordinates for d1bi1a2.
(The format of our PDB-style files is described here.)

Timeline for d1bi1a2: