Lineage for d3pvrb1 (3pvr B:2-236)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703653Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)
  8. 2703658Domain d3pvrb1: 3pvr B:2-236 [184015]
    Other proteins in same PDB: d3pvrb2, d3pvrc2
    automated match to d1otka_
    complexed with byc, gol

Details for d3pvrb1

PDB Entry: 3pvr (more details), 2.1 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with benzoyl-CoA
PDB Compounds: (B:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pvrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvrb1 a.25.1.2 (B:2-236) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaem

SCOPe Domain Coordinates for d3pvrb1:

Click to download the PDB-style file with coordinates for d3pvrb1.
(The format of our PDB-style files is described here.)

Timeline for d3pvrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pvrb2