Lineage for d3pvnr_ (3pvn R:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308105Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 1308106Protein C-reactive protein (CRP) [49954] (1 species)
  7. 1308107Species Human (Homo sapiens) [TaxId:9606] [49955] (5 PDB entries)
  8. 1308125Domain d3pvnr_: 3pvn R: [184012]
    automated match to d1b09a_
    complexed with ca, zn

Details for d3pvnr_

PDB Entry: 3pvn (more details), 1.98 Å

PDB Description: triclinic form of human c-reactive protein in complex with zinc
PDB Compounds: (R:) c-reactive protein

SCOPe Domain Sequences for d3pvnr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvnr_ b.29.1.5 (R:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOPe Domain Coordinates for d3pvnr_:

Click to download the PDB-style file with coordinates for d3pvnr_.
(The format of our PDB-style files is described here.)

Timeline for d3pvnr_: