| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) automatically mapped to Pfam PF00354 |
| Protein C-reactive protein (CRP) [49954] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49955] (6 PDB entries) |
| Domain d3pvnf_: 3pvn F: [184000] automated match to d1b09a_ complexed with ca, zn |
PDB Entry: 3pvn (more details), 1.98 Å
SCOPe Domain Sequences for d3pvnf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvnf_ b.29.1.5 (F:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp
Timeline for d3pvnf_: