![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries) Uniprot P33120 |
![]() | Domain d1dpra2: 1dpr A:65-136 [18400] Other proteins in same PDB: d1dpra1, d1dprb1 |
PDB Entry: 1dpr (more details), 3 Å
SCOPe Domain Sequences for d1dpra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpra2 a.76.1.1 (A:65-136) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs rspfgnpipgld
Timeline for d1dpra2: