SCOPe 2.08: Domain d3pvjb_: 3pvj B:

Lineage for d3pvjb_ (3pvj B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
   automatically mapped to Pfam PF02668

6. Protein automated matches [191275] (2 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [189871] (3 PDB entries)

8. Domain d3pvjb_: 3pvj B: [183991]
   automated match to d1gqwb_
   complexed with cl

Details for d3pvjb_

PDB Entry: 3pvj, 1.85 Å

PDB Description: crystal structure of the fe(ii)/alpha-ketoglutarate dependent taurine dioxygenase from pseudomonas putida kt2440

PDB Compounds: (B:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d3pvjb_:

Sequence; same for both SEQRES and ATOM records:

>d3pvjb_ b.82.2.5 (B:) automated matches {Pseudomonas putida [TaxId: 160488]}
sltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaar
fgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpayg
gdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnpp
lshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqen
dvafwdnrvtqhfavddyrpnrrvmhratilgdapf

Timeline for d3pvjb_:

• d3pvjb_ first appeared in SCOPe 2.01
  
• d3pvjb_ appears in SCOPe 2.07