SCOP 1.59: Domain d2dtr_2: 2dtr 65-140

Lineage for d2dtr_2 (2dtr 65-140)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)

4. Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries)

8. Domain d2dtr_2: 2dtr 65-140 [18399]
   Other proteins in same PDB: d2dtr_1, d2dtr_3

Details for d2dtr_2

PDB Entry: 2dtr, 2 Å

PDB Description: structure of diphtheria toxin repressor

SCOP Domain Sequences for d2dtr_2:

Sequence; same for both SEQRES and ATOM records:

>d2dtr_2 a.76.1.1 (65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

Timeline for d2dtr_2:

• d2dtr_2 first appeared (with stable ids) in SCOP 1.55
  
• d2dtr_2 appears in SCOP 1.57
  
• d2dtr_2 appears in SCOP 1.61
  
• d2dtr_2 appears in the current release, SCOPe 2.08, called d2dtra2