SCOPe 2.01: Domain d3puvg_: 3puv G:

Lineage for d3puvg_ (3puv G:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.58: MetI-like [161097] (1 superfamily)
   core: 5 transmembrane helices; flattened bundle

4. Superfamily f.58.1: MetI-like [161098] (1 family)

5. Family f.58.1.1: MetI-like [161099] (6 proteins)
   Pfam PF00528; Binding-protein-dependent transport system inner membrane component

6. Protein automated matches [191243] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189709] (6 PDB entries)

8. Domain d3puvg_: 3puv G: [183983]
   Other proteins in same PDB: d3puve_
   automated match to d2r6gg1
   complexed with adp, mal, mg, pgv, umq, vo4

Details for d3puvg_

PDB Entry: 3puv, 2.4 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4

PDB Compounds: (G:) Maltose transport system permease protein malG

SCOPe Domain Sequences for d3puvg_:

Sequence; same for both SEQRES and ATOM records:

>d3puvg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwklalgfsve
qadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatllkgmlif
qmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyfetidssl
eeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvnsytlavg
mqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg

Timeline for d3puvg_:

• d3puvg_ is new in SCOPe 2.01-stable
  
• d3puvg_ appears in SCOPe 2.02
  
• d3puvg_ appears in the current release, SCOPe 2.08