![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries) |
![]() | Domain d3puve1: 3puv E:1-370 [183982] Other proteins in same PDB: d3puva1, d3puva2, d3puva3, d3puvb1, d3puvb2, d3puve2, d3puvf1, d3puvf2, d3puvg_ automated match to d1anfa_ complexed with adp, mg, pgv, umq, vo4 |
PDB Entry: 3puv (more details), 2.4 Å
SCOPe Domain Sequences for d3puve1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3puve1 c.94.1.1 (E:1-370) automated matches {Escherichia coli K-12 [TaxId: 83333]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea lkdaqtritk
Timeline for d3puve1: