SCOPe 2.03: Domain d3pudb_: 3pud B:

Lineage for d3pudb_ (3pud B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (51 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries)

8. Domain d3pudb_: 3pud B: [183975]
   automated match to d1dhpa_
   complexed with gol, so4

Details for d3pudb_

PDB Entry: 3pud, 2.8 Å

PDB Description: Crystal structure of Dhydrodipicolinate synthase from Acinetobacter baumannii at 2.8A resolution

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3pudb_:

Sequence; same for both SEQRES and ATOM records:

>d3pudb_ c.1.10.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii

Timeline for d3pudb_:

• d3pudb_ first appeared in SCOPe 2.01
  
• d3pudb_ appears in SCOPe 2.02
  
• d3pudb_ appears in SCOPe 2.04
  
• d3pudb_ appears in the current release, SCOPe 2.08