Lineage for d1hnwg_ (1hnw G:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445404Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 445405Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 445406Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 445407Protein Ribosomal protein S7 [47975] (3 species)
  7. 445412Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries)
  8. 445420Domain d1hnwg_: 1hnw G: [18397]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwg_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (G:)

SCOP Domain Sequences for d1hnwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1hnwg_:

Click to download the PDB-style file with coordinates for d1hnwg_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwg_: