Lineage for d3ptfa_ (3ptf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1407111Protein automated matches [190124] (12 species)
    not a true protein
  7. 1407121Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries)
  8. 1407151Domain d3ptfa_: 3ptf A: [183968]
    Other proteins in same PDB: d3ptfc_, d3ptfd_
    automated match to d1z2ua1

Details for d3ptfa_

PDB Entry: 3ptf (more details), 2.7 Å

PDB Description: X-ray structure of the non-covalent complex between UbcH5A and Ubiquitin
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d3ptfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ptfa_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmlemalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltv
hfptdypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpn
pddplvpdiaqiyksdkekynrharewtqkyam

SCOPe Domain Coordinates for d3ptfa_:

Click to download the PDB-style file with coordinates for d3ptfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ptfa_: