SCOPe 2.07: Domain d1hnzg_: 1hnz G:

Lineage for d1hnzg_ (1hnz G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (4 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
   Uniprot P17291

8. Domain d1hnzg_: 1hnz G: [18396]
   Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
   complexed with hyg, mg, zn

Details for d1hnzg_

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1hnzg_:

Sequence; same for both SEQRES and ATOM records:

>d1hnzg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d1hnzg_:

• d1hnzg_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnzg_ appears in SCOPe 2.06
  
• d1hnzg_ appears in the current release, SCOPe 2.08